PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn058491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 573aa    MW: 62741.2 Da    PI: 7.0133
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn058491genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.88.9e-37198257261
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 ++k l+cprC+s +tkfCy+nny+++qPry+Ck+C+ryWt+GG+ rnvPvG+grrknk+ 
  Achn058491 198 PDKVLACPRCNSLETKFCYFNNYNVNQPRYYCKNCQRYWTAGGTTRNVPVGAGRRKNKHI 257
                 78999*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575122No hitNo description
ProDomPD0074782.0E-27195255IPR003851Zinc finger, Dof-type
PfamPF027013.3E-30199256IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.717202256IPR003851Zinc finger, Dof-type
PROSITE patternPS013610204240IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MEHKGLVPVL VLFLGFSFVL SCVAVPTSRS GPFSLVERNQ FESPFLNHFP LSHFFNNFDY  60
VKVKKFNQMW VNGVSNYDSL KKMNGGDALE TNKDSAIKLF GKTIPVPESH IPVNSEEISY  120
VGCQIPSKSE AQDLCKEITK MEAKDIHLAK SGNQGKYSVK YEDEQITGDE NEGQANVKTV  180
KDQVETSGIE TEKTLKKPDK VLACPRCNSL ETKFCYFNNY NVNQPRYYCK NCQRYWTAGG  240
TTRNVPVGAG RRKNKHIVSH YRQVLASPDT IPASGIEILD SANQQSLSSG ESRSHLRALT  300
SNGTLIKFGP EGRLCQSMAT VHLTDHNGVT SDLGSTRETI EEPSLCGSSI PPSSIKENSI  360
HEKANQHGSL NGSCIQLIQP NALQYYPVPP WIFPQNQVSN SGAQCSSELV SAPDDRNPIQ  420
WCPTPMLPVP GFYAPTVPLQ FVPASNWGYL PVCTVGTRVR SDVGLSSSSS TSNGCSGNNS  480
PTLGKHSRDG NSMDEEGSEN CVLVPKTLRI DDPYEASKSS IWATLGFNSN PKETDSRCGI  540
FRPYKSSGHQ SEGTEVLEAA ALSRSHTFQE ST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070363.11e-143PREDICTED: cyclic dof factor 3-like
TrEMBLA0A067KTT61e-143A0A067KTT6_JATCU; Uncharacterized protein
STRINGVIT_08s0056g01230.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2133022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-60cycling DOF factor 2