PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn041161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family bZIP
Protein Properties Length: 189aa    MW: 21889.4 Da    PI: 6.7429
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn041161genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.44.1e-1574123554
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                 +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN+ L+++l++ ++
  Achn041161  74 RKQRRMISNRESARRSRMRKQKHLDELWAQVVRLRNENHNLIDKLNHVSE 123
                 79******************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-1670134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.95572135IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-1374124No hitNo description
PfamPF001701.8E-1274123IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-1174147No hitNo description
CDDcd147022.15E-2075126No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MLPSEVAAIH YLASDYHSPF PTTFSMMPNN NTPFHLSRFL TQLPNTLHEF TPCLSNNSTS  60
DEAEEQQLNI IDERKQRRMI SNRESARRSR MRKQKHLDEL WAQVVRLRNE NHNLIDKLNH  120
VSESHDRVVQ ENSRLKEEAS DLHKMLTDLQ IGSPYPDLRY LEEVTCNTAH LRAESSNQSI  180
TTSTNLLH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18693RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027095835.13e-94basic leucine zipper 43-like
TrEMBLA0A2R6PH851e-135A0A2R6PH85_ACTCH; Basic leucine zipper like
STRINGVIT_01s0010g00930.t013e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-51basic leucine-zipper 42