PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn033491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family CO-like
Protein Properties Length: 361aa    MW: 38973.9 Da    PI: 5.8848
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn033491genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.7e-072362437
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                + C+++++  + lfC+ ++ +lC  C  + H+       H
  Achn033491 23 KPCDLCKSAVALLFCRVDSAFLCMGCDAKVHRVgngharH 62
                67***************************98335553345 PP

2zf-B_box27.75.7e-0965110342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  ++C+ +e+ +++  C+ +   lC+ C   +H+       H++vp+
  Achn033491  65 VWMCEVCEQAPASVTCKADAAALCAACDHDIHSAnplarrHERVPV 110
                 689*****************************66899999*99986 PP

3CCT706.2e-24285329145
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                 Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Achn033491 285 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 329
                 9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.2862067IPR000315B-box-type zinc finger
SMARTSM003360.112058IPR000315B-box-type zinc finger
PfamPF006438.9E-72362IPR000315B-box-type zinc finger
CDDcd000214.35E-82467No hitNo description
SMARTSM003364.5E-1463110IPR000315B-box-type zinc finger
PROSITE profilePS5011910.89363110IPR000315B-box-type zinc finger
PfamPF006435.3E-765110IPR000315B-box-type zinc finger
PfamPF062035.4E-18285327IPR010402CCT domain
PROSITE profilePS5101716.787285327IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGMGEGGGGG GKCYPAGWGI AAKPCDLCKS AVALLFCRVD SAFLCMGCDA KVHRVGNGHA  60
RHERVWMCEV CEQAPASVTC KADAAALCAA CDHDIHSANP LARRHERVPV APFFDSAETV  120
VKSAAAATFL VAADETGPNT ETATPSWVIP DPTGKALVDL PEMKSIDLFF SDSDQLLDFD  180
YPASLHNSGT DSVVPVQPVK SQQPITQEMM NPTSENYLEI DFSAPKLNYA AQSLSNSFSS  240
SSMDVGVVPD GSSVSEISYP FARPGHGSVD FCGSVNTTPC QWTDREARVL RYREKRKNRK  300
FEKTIRYASR KAYAETRPRI KGRFAKRSEI EPESIDRIFA SDSSEFMAEA AGYGVVPSFL  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028086202.11e-140zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-101COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A2R6Q8S10.0A0A2R6Q8S1_ACTCH; Zinc finger protein like
STRINGVIT_11s0052g01800.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-63CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]