PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn024831
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NF-YC
Protein Properties Length: 581aa    MW: 65950.3 Da    PI: 9.0708
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn024831genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.76.2e-192203001898
       NF-YC  18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                 ++++P arikki++ade+v +i+  +P l+ska elf+ +l  r++  + +   +t++   ++++v++ ++fdfl div +
  Achn024831 220 DTRFPAARIKKIMQADEEVGKIAMAVPLLVSKALELFLQDLCDRTYEITLQRGAKTVNSFHLKQCVQSFNVFDFLRDIVSK 300
                 678***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.2E-26217286IPR009072Histone-fold
SuperFamilySSF471132.73E-19218302IPR009072Histone-fold
PfamPF008081.5E-18222285IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MNSLEIYPKS LTSRYRIIGA NFQIRKKNIN PLQNINSAPN LHREQRTTHI KRLSGMSNQK  60
KTKNKRDKRD RIGKRERGRE IYLLRRREKA GRSIEIVIYS NGDWINFRER SRTEADTDTE  120
RKERERETDR YCEAKTESTE LGFYYKDRFG KRGFNLTGAL RLLMDNIIRR PKMYSAPFNP  180
VGDVAAKKKS IEEIGIPQKT RVPVTVGVLY SSNAMRKKLD TRFPAARIKK IMQADEEVGK  240
IAMAVPLLVS KALELFLQDL CDRTYEITLQ RGAKTVNSFH LKQCVQSFNV FDFLRDIVSK  300
VPDLGGSDAA GEDRSAAKRR KVADSEEHDS EDELKRGRMH EIGHTSSSGR GRGRGRGRGR  360
GRGSRTVDRE LIVHDVKLED DPDISQHDEK EKQNVGRLDN GAVPEGSKES IAISNNAEAT  420
ARNFDLNVDL NETVDSTTML PTTPAASSAK PVLETKHEEY PGWSLADMEK MAIDPVQLAN  480
LNRSIDEEEE DYDEEGLFFG CPVPASEWGG LFMETTDASS WLQLRSLYIE SNLKKYKNFE  540
MEEKIINFFG LGSKSGSDSD VLIRSVKYGS IEFGLHEFSD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A5e-20216286575Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15874QKKTKNKRDKRDRIGKR
2351361RGRGRGRGRGR
3353362RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA75552029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.15e-66NF-YC family protein