PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn020651
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family FAR1
Protein Properties Length: 861aa    MW: 98582.7 Da    PI: 6.3541
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn020651genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1773.6e-24182268290
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 +Yn+YA   GFs+rk+  +ks+ ng +++r+++C+keg+r+++ ++  + +r+r+ trtgC a+++++++ +gk++v+++e++HnHe+a
  Achn020651 182 CYNRYAALEGFSIRKDFVNKSRANGYVVSRRYTCYKEGYRRTKADT--NVKRPREDTRTGCLAHMTISRQPNGKYRVIHFETKHNHEFA 268
                 7****************************************99887..9999***********************************96 PP

2FAR194.99.4e-30315404191
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 +fYn+YA +vGFsvrk++ +ksk++g + +r+f+C +eg+r++++++ ++ +r+r+etr+gC a+l++ ++ dgk+++t++e++HnHel+p
  Achn020651 315 EFYNAYAGQVGFSVRKDYVNKSKKDGAVASRRFTCFREGFRQKDRRD-SNVKRPRKETRIGCSAQLVIARQADGKYRITRFEEKHNHELVP 404
                 6*******************************************999.999**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.0E-22182268IPR004330FAR1 DNA binding domain
PfamPF031018.6E-27315404IPR004330FAR1 DNA binding domain
PfamPF105511.2E-31525619IPR018289MULE transposase domain
PfamPF044346.6E-6794840IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.829805841IPR007527Zinc finger, SWIM-type
SMARTSM005753.3E-5816843IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MVGSETGTLS HSVEEEADDI SQTSTGLDFD VDLECQSLKV SAADKSGFET VGEKMCPSTE  60
VFSVDENREG IDNEQVYQSS KSSVVRSGMD KDDEHKCQSP EVSSVDKHGM DARGDQKGQN  120
SRDSLIDNHG MDIDSKLEYH CPDDQFADVS GSGYFSGNDE AETYVVPELG AEFDSEDHAY  180
RCYNRYAALE GFSIRKDFVN KSRANGYVVS RRYTCYKEGY RRTKADTNVK RPREDTRTGC  240
LAHMTISRQP NGKYRVIHFE TKHNHEFATP FTAHMLPSQR RTTFAEAVES EFANSVIDGV  300
PKLGMGFDSE DVAYEFYNAY AGQVGFSVRK DYVNKSKKDG AVASRRFTCF REGFRQKDRR  360
DSNVKRPRKE TRIGCSAQLV IARQADGKYR ITRFEEKHNH ELVPFCRVRM LRSQKRSAAV  420
EAAEVTPICS SGVQPNSTSD LIFKAVADRE GLRCHPIDYE SNLPEKRMRE MKQGESESIL  480
HYLQNKQLKD PSFFYAVQLD AEGQTTNFFW ADAKMLEDYG DFGDVVCFDT TYRLNKDYRP  540
FAPFIGVNHH KQMVVFGAAL LYDETVKSFL WLFQKFLEAM SGKKPKTILT DQDAIMAEAI  600
NSVLPEAHHR LCAWHVYQKA LKYLSETIVG LDSFASNFSS CVFSHDKEQD FVDAWKAMLD  660
VYGLWENEWL QDIFKEREKW AIPYGRHIFC ADIKGAQLSQ SFSTNLRKYL KSDLDVLQLF  720
KQFGKVVSDW RYKEIEANYD MSQRMPRLMG DVIVLKHARD LYTPTIFELF QQEYENSLNA  780
VVIQCTESQS LSEYKVNIYG QVLEHTVVFN SSEDSVVCSC MKFQFFGILC SHALKVLDYR  840
NIKVVPTRYI LKRWTKDARV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028122937.10.0protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2R6RZ120.0A0A2R6RZ12_ACTCH; Protein FAR1-RELATED SEQUENCE like
STRINGXP_008230452.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-127FAR1-related sequence 5