PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn017541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 319aa    MW: 34529.6 Da    PI: 6.492
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn017541genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.47.1e-2267115250
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                 C v+gC+adls+++eyhrrhkvCe hsk++vv++ g +qrfCqqCs f 
  Achn017541  67 CLVDGCQADLSSCREYHRRHKVCERHSKTAVVTIVGNKQRFCQQCSSFF 115
                 ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-2460139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.89664140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-2065115IPR004333Transcription factor, SBP-box
PfamPF031104.6E-1467114IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGSVSGSSSY GGQGMKGDFS VDLKLGHVVN AGNESTDNLQ VPSVPKMVSL PPKRARAVNN  60
GVQIASCLVD GCQADLSSCR EYHRRHKVCE RHSKTAVVTI VGNKQRFCQQ CSSFFKPDVS  120
QLFDCCYCRF HSLEEFDEEV YPTAALANPT WAGVVTTKQE AKLYNQNLFS GSSSSSHGAE  180
GKQFNFLHDT TLALSNQTVP EASTCQPFHK FVGGHNSCEM FCDGLSTQVL NSNCACSLLS  240
SQPLQTSETG LSYMVPPSSI LLAHPLGPSL HKSALESMDS HLVPNARDTD VHCQGMFHMG  300
RDSSSENEAS QTLPFCWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-1467137660squamosa promoter-binding protein-like 12
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028125244.11e-116squamosa promoter-binding-like protein 13A
TrEMBLA0A2R6QGB30.0A0A2R6QGB3_ACTCH; Squamosa promoter-binding-like protein
STRINGEOY225194e-94(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.16e-28SBP family protein