PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA9G00126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family G2-like
Protein Properties Length: 176aa    MW: 20178.1 Da    PI: 9.9391
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA9G00126genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.7e-28128176250
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHL 50 
                pr+rWt++LH+rFv+ave LGG+e+AtPk+ilelm+vk+Ltl+hvkSHL
  AA9G00126 128 PRMRWTTTLHSRFVHAVELLGGHERATPKSILELMDVKDLTLAHVKSHL 176
                9***********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.06E-13125176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-24126176IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-20128176IPR006447Myb domain, plants
PfamPF002494.2E-6129175IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MELFPPQPDL SLQISPPSTI DEEKELKLGF WRRGFDSKTS SLISKPNNSN SFDLISLSSN  60
NCNSHQLQQQ YLDGFFPHDL SYLRPISRTT LYHNDLLDSS SSSLCLKPKP NYKTLKSRFP  120
VKRSMRAPRM RWTTTLHSRF VHAVELLGGH ERATPKSILE LMDVKDLTLA HVKSHL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292116e-46BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934916e-46AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486896e-46AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361268.13e-52PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_006361269.13e-52PREDICTED: probable transcription factor KAN2 isoform X2
RefseqXP_009114900.13e-52PREDICTED: probable transcription factor KAN2 isoform X1
RefseqXP_013677345.13e-52PREDICTED: probable transcription factor KAN2 isoform X2
RefseqXP_013731603.13e-52PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6162e-50KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM1BKY03e-52M1BKY0_SOLTU; Uncharacterized protein
TrEMBLM4E3A33e-52M4E3A3_BRARP; Uncharacterized protein
TrEMBLM1BKY13e-52M1BKY1_SOLTU; Uncharacterized protein
STRINGBra023254.1-P9e-52(Brassica rapa)
STRINGPGSC0003DMT4000475329e-52(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.11e-35G2-like family protein