PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA9G00085
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 180aa    MW: 19594.2 Da    PI: 7.4672
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA9G00085genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.85.1e-45141131100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++l+ ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+la++++e
  AA9G00085  14 PCAACKLLRRRCAHDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELEIQQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDILQAQLAVAQAE 113
                7**********************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.42613114IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4414111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MKEGGNRKQG AASPCAACKL LRRRCAHDCV FAPYFPADEP QKFANVHKVF GASNVNKMLQ  60
ELEIQQRGDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DILQAQLAVA QAEVVHLRVR  120
HSTNLSSHGL VSPDSSNSGG SGSGSPLSKQ VIRPEDYNRV MFEHMDMVDQ ASLGESMWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-49101157112LOB family transfactor Ramosa2.1
5ly0_B8e-49101157112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA9G00085
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018486923.13e-92PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE92e-85LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A078INQ15e-90A0A078INQ1_BRANA; BnaCnng19520D protein
TrEMBLA0A0D3D5L95e-90A0A0D3D5L9_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EJ495e-90A0A3P6EJ49_BRAOL; Uncharacterized protein
STRINGBo7g041000.19e-91(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-77LOB domain-containing protein 4