PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA97G00011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 200aa    MW: 22485.7 Da    PI: 7.4476
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA97G00011genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.12e-201372357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq++ Le+l+++  r+psa+++++++ +l    +++ ++V++WFqN++a++++
  AA97G00011 13 SRWNPTKEQITLLENLYKQgIRTPSADQIQQITGRLraygQIEGKNVFYWFQNHKARQRQ 72
                8*****************99**************************************97 PP

2Wus_type_Homeobox116.99.3e-381174265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi++Le+lyk+G+rtP++++iq+it +L++yG+ie+kNVfyWFQN+kaR+rqkq
         AA97G00011 11 SSSRWNPTKEQITLLENLYKQGIRTPSADQIQQITGRLRAYGQIEGKNVFYWFQNHKARQRQKQ 74
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-12579IPR009057Homeodomain-like
PROSITE profilePS5007110.916873IPR001356Homeobox domain
SMARTSM003895.9E-51077IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-81372IPR009057Homeodomain-like
PfamPF000464.2E-181372IPR001356Homeobox domain
CDDcd000863.97E-61474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MENDGNTGTA SSSRWNPTKE QITLLENLYK QGIRTPSADQ IQQITGRLRA YGQIEGKNVF  60
YWFQNHKARQ RQKQKQERIA YFNRLLHKTS VSCGNPYYVQ QRAMSGSLRF DRFTLRDHSS  120
YSGGINVNSH QEYLEDSVGQ KTLPLFPLQP SDGGNSDFAL GCDSPVSSFS GDCDGGGIEQ  180
PFIDFFSDCS SRFDNTGNAL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA97G00011
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020868192.11e-86WUSCHEL-related homeobox 2
SwissprotQ6X7K17e-78WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLD7MSD91e-83D7MSD9_ARALL; Predicted protein
STRINGAl_scaffold_0008_24272e-84(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-73WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  3. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]