PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA96G00058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 208aa    MW: 24612.7 Da    PI: 5.3491
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA96G00058genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31.1e-3720117198
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                 aCaaCk++rr+Ca dC+lapyfpaeqpk f+nvh+lFG+++++k l++l+++++++am+s+++e+ +r r Pv+G++g+i++lq  l ++++e + ++
  AA96G00058  20 ACAACKYQRRRCAIDCPLAPYFPAEQPKLFQNVHRLFGVKRIIKKLEKLDDSQKPEAMKSIIFESYVRERSPVHGCLGMIQNLQYMLWTAEEEYKFIN 117
                 7*****************************************************************************************99987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.80219120IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3420114IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MFIFTILLIF MTLKGSNNGA CAACKYQRRR CAIDCPLAPY FPAEQPKLFQ NVHRLFGVKR  60
IIKKLEKLDD SQKPEAMKSI IFESYVRERS PVHGCLGMIQ NLQYMLWTAE EEYKFINLQL  120
QRYRPLPQQQ QRNQDTSQLD LELNNDCSMD TNTVNTHDTD WRISSYNVFD DNEDIKTIPS  180
LHHEKTREDE DENDNVHYFN NSYDEDTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-23161237114LOB family transfactor Ramosa2.1
5ly0_B1e-23161237114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA96G00058
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292170.13e-67LOB domain-containing protein 27
SwissprotQ9STS62e-66LBD27_ARATH; LOB domain-containing protein 27
TrEMBLR0HMD77e-66R0HMD7_9BRAS; Uncharacterized protein
STRINGCagra.13768s0012.1.p3e-67(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.17e-65LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]