PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA8G00037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 281aa    MW: 31337.3 Da    PI: 6.1504
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA8G00037genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.62.1e-4381071100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++lp+++reda++sl+yeAear+rdPvyG+vg+i+ lq++l++ ++e++ +k+ 
  AA8G00037   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFACVHKVFGASNVAKLLNELPTQTREDAVNSLYYEAEARLRDPVYGCVGLISILQHRLKTIQQEIENAKKD 107
                7*********************************************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5967108IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MASSSSSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFACV HKVFGASNVA KLLNELPTQT  60
REDAVNSLYY EAEARLRDPV YGCVGLISIL QHRLKTIQQE IENAKKDLAS HIGSQGLLPI  120
YNFNPPHPLE MLLAQTQNQD VGKVSLTIPT AQPLFVREQQ QHNFQIQQLQ QQMLNNFQVQ  180
NQNQEVLRFN NGLDSALMQP QPQPQSGSVT MTGISGGMLP SLALGTPFDY HTEQLQQHEV  240
AAPQTLQTSE TQTQTQMPIS DDEENRRTGI GGQSLANFEN K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4841197123LOB family transfactor Ramosa2.1
5ly0_B1e-4841197123LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA8G00037
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103474.15e-77PREDICTED: LOB domain-containing protein 36
RefseqXP_009103475.15e-77PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ33e-74LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1J3JA735e-77A0A1J3JA73_NOCCA; LOB domain-containing protein 36
STRINGBra012112.1-P2e-76(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-70ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]