PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA87G00242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 612aa    MW: 68559 Da    PI: 5.2261
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA87G00242genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.83.4e-16328366240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  AA87G00242 328 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 366
                 689**********************************96 PP

2TCR51.32.4e-16410448139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  AA87G00242 410 RHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNA 448
                 589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19327368IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.832328450IPR005172CRC domain
PfamPF036385.7E-12330365IPR005172CRC domain
SMARTSM011143.7E-17410451IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.4E-12412448IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MQDSPVFNYI NSLSPIRPLK SSSNSHQFTS LNFTSPPSVF TSPHITSRFF KSHRSLESQN  60
ESNSKEEIEE TTKEDTPMVE EQEQEQEPEQ EKESSIEMDI PQILEFSPDS SAKDIDELSL  120
VPYVRGENVD LQKMYNNVES KNETPDWDSL ISDASELLIF GSPNDSEAFR CLMMQKADVI  180
PTTMESNAEL AESSEAGSLL HRGLRRRCLD FEMPRNKQTM NDNNMKRCVV PSIGLHLNAI  240
AMSSKDCKKS NVVHEYSSLG KIQVSLPGSS STMYAQNIEN SDQKIEIELR EDVNREVEEV  300
PAETALEELN ISSPKKKKPK FEAGEGESCK RCNCKKSKCL KLYCECFAAG VYCIEPCSCI  360
DCFNKPIHED VVLATRKQIE SRNPLAFAPK VINSVLETGD DTTKTPASAR HKRGCNCKKS  420
NCLKKYCECY QGGVGCSINC RCEGCKNAFG RKDGSSFVDM EGDQEEETET SEKTVTAKTQ  480
HQTDVLMNKE EQNLSSVLPT TPMYRQELVQ MPFSYKTRLP PQQSLLGAGS SLNNHQQYFR  540
KPEITLAQPR HETIAEDLPE ILIESPVSDT KTGSPNSKRV SPPHLDSLGR RSGGRKLILQ  600
SIPAFPSLTP QH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1633044712120Protein lin-54 homolog
5fd3_B1e-1633044712120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA87G00242
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282514.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLR0F1B10.0R0F1B1_9BRAS; Uncharacterized protein
STRINGXP_006282514.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]