PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA71G00021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 327aa    MW: 37036.2 Da    PI: 4.3426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA71G00021genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.32.8e-12161207450
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                 +k+ rr+ +NR AA rsR+RKk++++ Le+k+k Le e ++L   l+
  AA71G00021 161 DKKRRRRLRNRDAAVRSRERKKEYVKDLETKSKYLERECMRLGRMLQ 207
                 79*************************************99976665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-14156220No hitNo description
SMARTSM003387.7E-10158222IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.622160217IPR004827Basic-leucine zipper domain
PfamPF001704.6E-10161216IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-11162219No hitNo description
PROSITE patternPS000360165180IPR004827Basic-leucine zipper domain
CDDcd147041.20E-12172214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTEDFDGLEL FVDDAFFFDF DCDSSESPPA EDFIGSSPDS STSWIGQIES QLMNDENHEE  60
LNFTDQQSVS EFLADIFVDC PSADSGSVDF ATAEVSDIPA IDLTSDKFTT EKESDVFNDS  120
PKEKEEFLIE KKSDESNDSG SENSDRTKAE DEIEGNDDSV DKKRRRRLRN RDAAVRSRER  180
KKEYVKDLET KSKYLERECM RLGRMLQCCV AENQSLRLFL EKGGKTYDAS MTKQESAVLL  240
LESLLLGSLL WYMVSIICSF PQPHAGCWLP PMVTEEPKNL VPRGQGSSNI PFTFTSFLGN  300
SRRCKGSRPR MKRQQTLPFM ARDQAVA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160167DKKRRRRL
2161166KKRRRR
3162167KRRRRL
4162181KRRRRLRNRDAAVRSRERKK
5164170RRRLRNR
6164181RRRLRNRDAAVRSRERKK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the unfolded protein response (UPR). Acts during endoplasmic reticulum stress (ER) by activating unfolded protein response (UPR) target genes via direct binding to the UPR element (UPRE). Plays a role in plant immunity and abiotic stress responses. {ECO:0000269|PubMed:15781873, ECO:0000269|PubMed:18574595, ECO:0000269|PubMed:19017746, ECO:0000269|PubMed:21482766, ECO:0000269|PubMed:22359644}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA71G00021
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By tunicamycin, DTT and azetidine-2-carboxylate. Isoform 2 is induced by heat. {ECO:0000269|PubMed:15781873, ECO:0000269|PubMed:21482766}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395999.17e-92bZIP transcription factor 60
SwissprotQ9C7S09e-69BZP60_ARATH; bZIP transcription factor 60
TrEMBLV4K6S22e-90V4K6S2_EUTSA; Uncharacterized protein
STRINGXP_006395999.13e-91(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-61basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Deng Y,Srivastava R,Howell SH
    Protein kinase and ribonuclease domains of IRE1 confer stress tolerance, vegetative growth, and reproductive development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(48): p. 19633-8
    [PMID:24145452]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
    Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis.
    Plant Cell Physiol., 2014. 55(10): p. 1772-8
    [PMID:25138441]
  4. Parra-Rojas J,Moreno AA,Mitina I,Orellana A
    The dynamic of the splicing of bZIP60 and the proteins encoded by the spliced and unspliced mRNAs reveals some unique features during the activation of UPR in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0122936
    [PMID:25860807]
  5. Zhang L,Chen H,Brandizzi F,Verchot J,Wang A
    The UPR branch IRE1-bZIP60 in plants plays an essential role in viral infection and is complementary to the only UPR pathway in yeast.
    PLoS Genet., 2015. 11(4): p. e1005164
    [PMID:25875739]
  6. Walley J, et al.
    Plastid-produced interorgannellar stress signal MEcPP potentiates induction of the unfolded protein response in endoplasmic reticulum.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(19): p. 6212-7
    [PMID:25922532]
  7. Ma ZX, et al.
    The THERMOSENSITIVE MALE STERILE 1 Interacts with the BiPs via DnaJ Domain and Stimulates Their ATPase Enzyme Activities in Arabidopsis.
    PLoS ONE, 2015. 10(7): p. e0132500
    [PMID:26186593]
  8. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  9. Deng Y, et al.
    IRE1, a component of the unfolded protein response signaling pathway, protects pollen development in Arabidopsis from heat stress.
    Plant J., 2016. 88(2): p. 193-204
    [PMID:27304577]
  10. Gaguancela OA, et al.
    The IRE1/bZIP60 Pathway and Bax Inhibitor 1 Suppress Systemic Accumulation of Potyviruses and Potexviruses in Arabidopsis and Nicotiana benthamiana Plants.
    Mol. Plant Microbe Interact., 2016. 29(10): p. 750-766
    [PMID:27578623]
  11. Meng Z,Ruberti C,Gong Z,Brandizzi F
    CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses.
    Plant J., 2017. 89(3): p. 486-501
    [PMID:27747970]
  12. Wang B,Du H,Zhang Z,Xu W,Deng X
    BhbZIP60 from Resurrection Plant Boea hygrometrica Is an mRNA Splicing-Activated Endoplasmic Reticulum Stress Regulator Involved in Drought Tolerance.
    Front Plant Sci, 2017. 8: p. 245
    [PMID:28286511]
  13. Li Q, et al.
    Unfolded protein response activation compensates endoplasmic reticulum-associated degradation deficiency in Arabidopsis.
    J Integr Plant Biol, 2017. 59(7): p. 506-521
    [PMID:28418178]
  14. Zhang SS, et al.
    Tissue-Specific Transcriptomics Reveals an Important Role of the Unfolded Protein Response in Maintaining Fertility upon Heat Stress in Arabidopsis.
    Plant Cell, 2017. 29(5): p. 1007-1023
    [PMID:28442596]
  15. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  16. Ruberti C,Lai Y,Brandizzi F
    Recovery from temporary endoplasmic reticulum stress in plants relies on the tissue-specific and largely independent roles of bZIP28 and bZIP60, as well as an antagonizing function of BAX-Inhibitor 1 upon the pro-adaptive signaling mediated by bZIP28.
    Plant J., 2018. 93(1): p. 155-165
    [PMID:29124827]
  17. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]