PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA60G00005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 119aa    MW: 13593.8 Da    PI: 8.8351
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA60G00005genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.71.6e-3771061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C++dC+++pyfp ++p+kfa++hk++Ga nv+k+l++lp ++r++a++s+ +eAe+r +dPvyG+vg+i+ lq +++q+++ la++++
  AA60G00005   7 RCAACKYLRRRCPQDCIFSPYFPPNSPEKFACIHKIYGAGNVSKMLHQLPVQTRSEAVESMWFEAECRRDDPVYGVVGIIHLLQIHIQQTQNLLAKTQA 105
                 6********************************************************************************************999998 PP

      DUF260 100 e 100
                 e
  AA60G00005 106 E 106
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.5456107IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-367104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MMNPTKRCAA CKYLRRRCPQ DCIFSPYFPP NSPEKFACIH KIYGAGNVSK MLHQLPVQTR  60
SEAVESMWFE AECRRDDPVY GVVGIIHLLQ IHIQQTQNLL AKTQAEIAAS RSNIVKPDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-34810712111LOB family transfactor Ramosa2.1
5ly0_B4e-34810712111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA60G00005
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189300.11e-61LOB domain-containing protein 24
SwissprotP594689e-63LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A291LR103e-60A0A291LR10_BRARR; Transcription factor LBD23
STRINGBostr.0556s0333.1.p1e-61(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-54LOB domain-containing protein 24