PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00219
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TCP
Protein Properties Length: 223aa    MW: 23844.7 Da    PI: 10.2545
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00219genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1226.9e-38999293
        TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaks 93
               ++kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++a+++ ++s s  +s+ss++++   
  AA5G00219  9 TVKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPATFS-TASLSIRTSTSSIEQKPFR 99
               689**************************************************************9999666.5555555555555533333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.1E-3415106IPR005333Transcription factor, TCP
PROSITE profilePS5136927.8921569IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSNTPEALTV KKPPAKDRHS KVDGRGRRIR MPIICAARVF QLTRELGHKS DGQTIEWLLR  60
QAEPSIIAAT GTGTTPATFS TASLSIRTST SSIEQKPFRK RLRSDEGEEK IGELGEIGEG  120
GVTIGHTMMG SGVNGGGFWS SVPRVDFGQQ LWSFGIGNNQ ESFMQQQQQS MTGLYLSQQR  180
FAAIGEASAA RVGNYLPGHL NLLASLSSSS TSGAGVTGSS SER
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA5G00219
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022743432.13e-75transcription factor TCP7-like
RefseqXP_022743440.13e-75transcription factor TCP7-like
SwissprotQ9FMX21e-74TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A1J3E1H45e-76A0A1J3E1H4_NOCCA; Transcription factor TCP7 (Fragment)
TrEMBLA0A1J3ITE15e-76A0A1J3ITE1_NOCCA; Transcription factor TCP7 (Fragment)
STRINGA0A087HAP07e-76(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.14e-54TCP family protein