PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00027
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Dof
Protein Properties Length: 323aa    MW: 34745.4 Da    PI: 8.7624
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00027genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.5e-3942101362
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  AA5G00027  42 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 101
                6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-353095IPR003851Zinc finger, Dof-type
PfamPF027019.6E-334399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7614599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MLDSSTTNSP SAADILAACT TRPQLAAAAL MDGGRRLRPP HDHPQKCPRC ESTHTKFCYY  60
NNYSLSQPRY FCKTCRRYWT KGGTLRNIPV GGGCRKNKKP SSNSSSSSAS VSTTSSSSGK  120
KPSNVGVITT HHANDFANLV HSQQNYQNTP VGFGGFGGGM SSFGGGQEYG FLESKFSGLI  180
SQNPKPIDFL DSKFDLMGVN NHHDMGMVDH HHHNMGMNHG GGGGIMDMTC QRLMLSNYDQ  240
HHYNNNNNNH DDQRVTIMDV KPNPKMLSLD WQVQEQGCSN GGGGKVDGGG YSGGAGGYIN  300
GLGSSWNGFI NGYGSSTKTN SLV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1282289GGKVDGGG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA5G00027
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607164.11e-116PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-112DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A1J3IWB01e-115A0A1J3IWB0_NOCCA; Dof zinc finger protein DOF5.6
STRINGBo9g016320.11e-116(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.19e-77Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]