PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA57G00162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 291aa    MW: 31609.2 Da    PI: 8.0009
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA57G00162genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222137.4e-6621431146
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR +Gnyklpk++DnneVlkALc+eAGw+vedDGttyrkg+kpl++ e +g s+sasp+ss+q    
  AA57G00162   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRVHGNYKLPKHCDNNEVLKALCNEAGWTVEDDGTTYRKGCKPLDRIELMGGSTSASPCSSYQ---- 96 
                 5899*******************************************************************************************.... PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslv 146
                     +sp++sy++sp+sssfpsp  +   s++++    +sl+p+l++ls+ 
  AA57G00162  97 ----PSPRASYNPSPSSSSFPSPRGSHYPSTTNPfgdaNSLIPWLKNLSSN 143
                 ....99999999999999999998877777776677779*******99863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.1E-643141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRVHGNY KLPKHCDNNE VLKALCNEAG  60
WTVEDDGTTY RKGCKPLDRI ELMGGSTSAS PCSSYQPSPR ASYNPSPSSS SFPSPRGSHY  120
PSTTNPFGDA NSLIPWLKNL SSNSPSKLPF FHGNSISAPV TPPIARSPTH EQITIPDSGW  180
LSGMQTPQSG PSSPTFSLVS RNPFFDKEGF KIGECSPMWT PGQSGNCSPV IPAGIEESSD  240
VPMGDEMAAE FAFGCNANAA FGIVKPWEGE RIHEGCVSDD LELTLGNSRT R
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00444DAPTransfer from AT4G18890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010434483.11e-162PREDICTED: BES1/BZR1 homolog protein 3
RefseqXP_010439796.11e-162PREDICTED: BES1/BZR1 homolog protein 3
RefseqXP_010449452.11e-162PREDICTED: BES1/BZR1 homolog protein 3
SwissprotO494041e-164BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLQ2HIR91e-162Q2HIR9_ARATH; At4g18890
STRINGAT4G18890.11e-161(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-134BES1/BZR1 homolog 3