PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA56G00080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 350aa    MW: 38963.1 Da    PI: 7.1
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA56G00080genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox542.9e-1760120257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++++eq+++Le+ F++   +p +ee++++  +l    ++ +++V++WFqNr+ + k+
  AA56G00080  60 KPRWNPKPEQIRILESIFNSgMINPPREEIKKIRIRLqefgQIGDANVFYWFQNRKSRAKH 120
                 89*****************99*************************************995 PP

2Wus_type_Homeobox108.53.9e-3559121264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+ +P++eei++i+ +L+e+G+i+d+NVfyWFQNrk+R ++k
         AA56G00080  59 PKPRWNPKPEQIRILESIFNSGMINPPREEIKKIRIRLQEFGQIGDANVFYWFQNRKSRAKHK 121
                        579**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.20356121IPR001356Homeobox domain
SuperFamilySSF466891.24E-1158125IPR009057Homeodomain-like
SMARTSM003894.5E-758125IPR001356Homeobox domain
CDDcd000862.23E-859121No hitNo description
Gene3DG3DSA:1.10.10.602.4E-660120IPR009057Homeodomain-like
PfamPF000467.0E-1560120IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MSSSKKNWPS MFKSKPCNNH HHHHDMDTPS YMHYSNCNTS NSHFSAVNYY MITDRVPDPK  60
PRWNPKPEQI RILESIFNSG MINPPREEIK KIRIRLQEFG QIGDANVFYW FQNRKSRAKH  120
KLRVLQQKVP KISGLGPNKT NNHKEKHIAL SNDDVNPCFG LVNQETGLFP GQNNELVITE  180
PAGFPLPVYS DPRETQVGFG LVTEEGMGFN GVNNGVRLEM GESLTTIPAV NFYGGDNDGG  240
GSCYSPISVP VTVPLTVHQT QAPGDIVLYG GGDAGDCVSP VRLTVFINDM PFEVVAGLFN  300
VREAFGNDAV LINSSGEPIL TDEFGVTLQP LQNGAVYYLV RLFKRLQNLN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor, which may be involved in embryonic patterning (PubMed:14711878). May be required for basal embryo development after fertilization (PubMed:14711878). Acts partially redundantly with STIP in promoting embryonic cell division and proliferation (PubMed:17706632). Promotes cotyledon boundary formation by maintaining the symmetry in CUC genes expression domains (PubMed:22827849). {ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:22827849, ECO:0000303|PubMed:14711878}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA56G00080
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2 (PubMed:21316593). Up-regulated by CLE8 (PubMed:22427333). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:22427333}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002865213.11e-159WUSCHEL-related homeobox 8 isoform X1
SwissprotQ6X7J51e-156WOX8_ARATH; WUSCHEL-related homeobox 8
TrEMBLD7MSP01e-158D7MSP0_ARALL; Uncharacterized protein
STRINGscaffold_800245.11e-158(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142621619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.11e-159WUSCHEL related homeobox 8
Publications ? help Back to Top
  1. Xiao W, et al.
    DNA methylation is critical for Arabidopsis embryogenesis and seed viability.
    Plant Cell, 2006. 18(4): p. 805-14
    [PMID:16531498]
  2. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  3. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  4. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]