PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 131aa    MW: 14657.6 Da    PI: 7.7886
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01013genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.72e-4310108199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC++dCv+apyf  e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el+++++
  AA53G01013  10 PCAACKFLRRKCTQDCVFAPYFSPEEPTKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVLTLQRELEETNA 108
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4369110IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MSYSSYTNSP CAACKFLRRK CTQDCVFAPY FSPEEPTKFA NVHRIFGASN VSKILHEVAP  60
HQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVLTLQ RELEETNADL MRYASCQLGP  120
ETTSSYGARR V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5981199120LOB family transfactor Ramosa2.1
5ly0_B2e-5981199120LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA53G01013
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566823.12e-82LOB domain-containing protein 25
SwissprotQ8L8Q32e-83LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A178VKF44e-81A0A178VKF4_ARATH; LBD25
TrEMBLA0A178VL464e-81A0A178VL46_ARATH; LBD25
STRINGAT3G27650.17e-82(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.16e-86LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]