PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 118aa    MW: 13379.5 Da    PI: 8.8366
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00875genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601247.8e-3961051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C++dC+++pyfp ++p+kfa +h+++Ga nv+k+l++lp ++r +a++s+++eA+ ra+dPvyG+vg+i+ lq +++++++ la++++
  AA53G00875   6 RCAACKYLRRRCPQDCIFSPYFPPNDPQKFASIHRIYGAGNVSKMLQQLPIQTRAAAVESMCFEAQSRAEDPVYGCVGIIHLLQIHIQETQNLLAKTQA 104
                 6*******************************************************************************************9999998 PP

      DUF260 100 e 100
                 e
  AA53G00875 105 E 105
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5845106IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-396103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MNPRKRCAAC KYLRRRCPQD CIFSPYFPPN DPQKFASIHR IYGAGNVSKM LQQLPIQTRA  60
AAVESMCFEA QSRAEDPVYG CVGIIHLLQI HIQETQNLLA KTQAEIAVAR TNIVKEDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-36710612111LOB family transfactor Ramosa2.1
5ly0_B7e-36710612111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA53G00875
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189300.15e-65LOB domain-containing protein 24
SwissprotP594684e-66LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A291LR101e-62A0A291LR10_BRARR; Transcription factor LBD23
STRINGAT3G26660.12e-64(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-68LOB domain-containing protein 24