PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Whirly
Protein Properties Length: 287aa    MW: 31601.8 Da    PI: 9.4889
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00719genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly2194.1e-681102481139
      Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePl 99 
                 s+yk+kaal++++++p+f+al+sg++kl+++G+l+l++a+a+++r+ydW++kq+f+ls+te+++l++l++kesceffhdp++++++eGkvrk+lkvePl
  AA53G00719 110 SIYKGKAALTIEPRAPEFVALESGAIKLSKEGFLILQFAPAAGVRQYDWSRKQVFSLSVTEIGNLISLGPKESCEFFHDPFKGKGDEGKVRKVLKVEPL 208
                 7************************************************************************************************** PP

      Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                 pdGsG f+nlsv+n+l++++es+++P++kaefavl+s+++
  AA53G00719 209 PDGSGRFFNLSVQNKLLNVDESVYIPITKAEFAVLISAFN 248
                 *************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.6E-77101270IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.75E-80103287IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.8E-59111245IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSQLLSSSPR MVLNSKSLIT HQLTDASFLS SYSALTVGGF AGKRYGVAMK PTGRVELSVN  60
SRQADYFEKQ RFGDSSSSPA YSPQNGSSYG SFDKYCSLGL AEGRFYVGHS IYKGKAALTI  120
EPRAPEFVAL ESGAIKLSKE GFLILQFAPA AGVRQYDWSR KQVFSLSVTE IGNLISLGPK  180
ESCEFFHDPF KGKGDEGKVR KVLKVEPLPD GSGRFFNLSV QNKLLNVDES VYIPITKAEF  240
AVLISAFNFI LPHLIGWQAF ANSIKPEDAN RLNNSSVKYG GDYEWNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koq_A1e-1131042658169Single-stranded DNA-binding protein WHY3, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0156410.0BT015641.1 Arabidopsis thaliana At2g02740 gene, complete cds.
GenBankBT0153360.0BT015336.1 Arabidopsis thaliana At2g02740 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077872.11e-159single-stranded DNA-binding protein WHY3
SwissprotQ66GR61e-159WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
TrEMBLR0H5N71e-156R0H5N7_9BRAS; Uncharacterized protein
STRINGAT2G02740.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50232752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-163ssDNA-binding transcriptional regulator