PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 211aa    MW: 24926.9 Da    PI: 6.4048
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00632genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.22.4e-221271357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++t+eq++ Lee++++ +r+p++e+++e+A kl    +++ ++V++WFqN++a+e++
  AA53G00632 12 SRWNPTPEQITMLEEVYKSgTRTPTTEQIQEIAIKLrkfgKIEGKNVFYWFQNHKARERQ 71
                7*****************99**************************************97 PP

2Wus_type_Homeobox116.11.7e-371173365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+PtpeQi++Lee+yksG+rtP++e+iq+i+ +L+++Gkie+kNVfyWFQN+kaRerqk+
         AA53G00632 11 SSRWNPTPEQITMLEEVYKSGTRTPTTEQIQEIAIKLRKFGKIEGKNVFYWFQNHKARERQKR 73
                       79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-14774IPR009057Homeodomain-like
PROSITE profilePS5007111.904772IPR001356Homeobox domain
SMARTSM003895.0E-7976IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-91271IPR009057Homeodomain-like
PfamPF000465.7E-201271IPR001356Homeobox domain
CDDcd000862.45E-61373No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MISSGKSSSG SSRWNPTPEQ ITMLEEVYKS GTRTPTTEQI QEIAIKLRKF GKIEGKNVFY  60
WFQNHKARER QKRRRPDLDD HHTLNLRQHL NISSSGYFQF FFNVNFVVYE MELAPESYTK  120
DNIEDHGTTK ESETKSEDRK DATWMNLIHP INSEDCDLII TSLEEKREIR TLDLFPVKEN  180
QEKTGGLELI EESNHSRCNY CYYYEFIPLK K
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that plays a central role in ovule patterning by regulating cell proliferation of the maternal integuments and differentiation of the maegaspore mother cell (MCC). Involved in AGAMOUS (AG) repression in leaves. {ECO:0000269|PubMed:15659481}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA53G00632
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020880920.14e-64WUSCHEL-related homeobox 6
SwissprotQ9ZVF53e-54WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLD7LLR91e-62D7LLR9_ARALL; HOS9/PFS2
STRINGfgenesh2_kg.5__60__AT2G01500.12e-63(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.12e-54WOX family protein