PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YC
Protein Properties Length: 191aa    MW: 21767.6 Da    PI: 9.8509
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00549genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC49.59.6e-16881731499
       NF-YC  14 tdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 ++ k  ++P+ ri++i+++d+  ++i  +a  l+ ka e+f+  +t  ++  + + k++ ++   ++++v++ + ++fl d vp++
  AA53G00549  88 EETKTFRFPMNRIRRIMRSDNTAHQIMQDAVFLVNKATEMFMDRFTEEAYESSVQDKKKFIHYKHLSSVVSNEERYEFLADCVPEK 173
                 5678889****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.02E-2077172IPR009072Histone-fold
PfamPF008082.3E-2094157IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.4E-2495172IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MKEKEKKTRG DGVCTTGKRK IRSAASKNRK PPSKIHRAIP SEVHEISETS SSDSTEEARD  60
GGGVESRKMV KARVEKNHRD SVIGGGVEET KTFRFPMNRI RRIMRSDNTA HQIMQDAVFL  120
VNKATEMFMD RFTEEAYESS VQDKKKFIHY KHLSSVVSNE ERYEFLADCV PEKLRADVAL  180
EQWKTAMADA A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695920.17e-68PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLA0A087HLV71e-71A0A087HLV7_ARAAL; Uncharacterized protein
STRINGBra031606.1-P5e-62(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.15e-59nuclear factor Y, subunit C10