PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family G2-like
Protein Properties Length: 357aa    MW: 40680.7 Da    PI: 8.7638
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00212genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32243296255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  AA53G00212 243 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 296
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.74E-15240296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28241296IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23243296IPR006447Myb domain, plants
PfamPF002492.3E-7244295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPSST KPSWQNIRRS TEEEEESDNN QELDLGFWRR ALDSRTSSLV  60
SNSNSKTNTN SFLENLSLSN NSHHHNHHHK QHPQHHHHHQ NQHQNQLHHP HLLPNCNASN  120
ILTSLQFQTQ QQNQNQHFLG HDLTHLRPIR GIPLYQNPPQ HHRQPPHPNP PPCFPFDPSS  180
LLPSSTSTSP SFSGNNNNSF GSNSVVSNSG LITNPNYHNH HHQSLNRARF MPRFPAKRSM  240
RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT  300
DKAGASSGQS EVYENGSSGD NNSDDWMFDM NRKSRDSDEI LMNRVEKSNG LWTNSSG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613867.11e-147PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-139KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR211e-147A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGBra033844.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-94G2-like family protein