PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 136aa    MW: 14701.6 Da    PI: 7.0709
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26056.76.8e-18308149100
      DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 lp e+r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+lal+++e
  AA53G00004  30 LPMEQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQAQLALAQAE 81 
                 7889*******************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.363182IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-163079IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAHDCEL PMEQRGDAVS SMVYEANARV RDPVYGCVGA  60
ISSLQQQIDV LQAQLALAQA EVVHLRVRHS THLSSHVACS DSPSSSGSPP QGNKGMFNNH  120
MDIMDEASLG ESMWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-219837112LOB family transfactor Ramosa2.1
5ly0_B2e-219837112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA53G00004
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018486923.12e-64PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE92e-58LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A078INQ19e-63A0A078INQ1_BRANA; BnaCnng19520D protein
TrEMBLA0A0D3D5L99e-63A0A0D3D5L9_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EJ499e-63A0A3P6EJ49_BRAOL; Uncharacterized protein
STRINGBo7g041000.11e-63(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-52LOB domain-containing protein 4