PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 281aa    MW: 32799.7 Da    PI: 4.7329
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00616genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.28.4e-15251031496
                 T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
          B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                   +v+pk++ + +   ++ +kt +l  ++gr W+vk + + +++++ +++GW++Fvk+n+L++ Df+ +++dg ++f   +++
  AA44G00616  25 ESFVIPKDYKKYYP--NPLPKTAVLWMQEGRFWNVKWTKSEQDSTISFQDGWNKFVKDNNLQDDDFIHITYDGIRSF--SIQI 103
                 459*****975555..45999****************77777777**************************987777..5555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.56212107IPR003340B3 DNA binding domain
SMARTSM010194.1E-619107IPR003340B3 DNA binding domain
CDDcd100178.48E-1523104No hitNo description
Gene3DG3DSA:2.40.330.101.8E-1524105IPR015300DNA-binding pseudobarrel domain
PfamPF023623.8E-1225103IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-1726105IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.12190280IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MTLDNNGVPY YPDLLIRYNA IKFSESFVIP KDYKKYYPNP LPKTAVLWMQ EGRFWNVKWT  60
KSEQDSTISF QDGWNKFVKD NNLQDDDFIH ITYDGIRSFS IQIYQNGVVK KTNKSLAIQE  120
ISSSDDNDDN DDKEDGDDDN ITISLSYDSG QNDDDDDDIE SFEIGRTPRT VKRGDINNLQ  180
KYLDDPTNLF FIATSSSKRH LLVVPKKIRL ENELKFGPTI NLIDEFGEIV SKVRAQIDRV  240
VIWRWDEMYQ RNNAKRGDLI ICEIICHQAF LKSIKVHFVK E
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA44G00616
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866225.11e-76B3 domain-containing protein At5g57720 isoform X2
TrEMBLD7MNV03e-75D7MNV0_ARALL; Uncharacterized protein
STRINGBostr.26833s0482.1.p8e-79(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137971723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57720.14e-71B3 family protein