PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA43G00008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 368aa    MW: 41287 Da    PI: 8.501
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA43G00008genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-1846106257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  AA43G00008  46 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 106
                 89*****************99*************************************995 PP

2Wus_type_Homeobox112.42.3e-3645107264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
         AA43G00008  45 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 107
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-729105IPR009057Homeodomain-like
SuperFamilySSF466891.71E-1242110IPR009057Homeodomain-like
PROSITE profilePS5007110.68942107IPR001356Homeobox domain
SMARTSM003895.1E-944111IPR001356Homeobox domain
CDDcd000863.44E-845107No hitNo description
PfamPF000468.3E-1646106IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHPHQ WQHDINSPHR SSPFSSGCEE RSPEPKPRWN PKPEQIRILE  60
AIFNSGMVNP PREEIRRIRA QLQEYGQVGD ANVFYWFQNR KSRSKHKLRL HSKHSLTQSQ  120
TQSQSQTQSL SSPSSSSSPS PKSTKPRKNK NNNNNNNTSS NTNLSLMGMS PSEAAFLFPV  180
SSTGGGYEGM NSSSSQLGFL TSEIMMNNNV EEHQKATSGL LLSELMNNNT SVSYTTPLHP  240
PHHHHHHHLI TKEDEEMRMK MMMLQPQICC YNNILLNPQI TTSSSSTTTS DSVIVTVPST  300
SEHLHLQGGG VRKRIFINEM EVEITSGAFN VREAFGEEAV LIDSEGQPLL TDQFGVALNP  360
LQHGASYY
Functional Description ? help Back to Top
Source Description
UniProtHomeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA43G00008
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024003959.11e-149WUSCHEL-related homeobox 9 isoform X1
SwissprotQ6X7J41e-137WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLV4M6W21e-146V4M6W2_EUTSA; Uncharacterized protein
STRINGXP_006410541.11e-147(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-116homeobox-3
Publications ? help Back to Top
  1. Wang W, et al.
    Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
    PLoS Genet., 2014. 10(3): p. e1004154
    [PMID:24625559]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce.
    J. Exp. Bot., 2014. 65(22): p. 6543-52
    [PMID:25205582]
  3. Raines T, et al.
    The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis.
    Plant J., 2016. 85(1): p. 134-47
    [PMID:26662515]
  4. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  5. Blein T,Pautot V,Laufs P
    Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection.
    Plants (Basel), 2013. 2(2): p. 230-47
    [PMID:27137374]