PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family M-type_MADS
Protein Properties Length: 392aa    MW: 45013.4 Da    PI: 4.8626
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00158genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.85.9e-181353343
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                ie+++ r +tf kR++g+lKK +ELS+LCd++ + ii+s+ 
  AA40G00158 13 IEDETTRRTTFKKRQKGLLKKVYELSTLCDVQTCAIIYSPY 53
                9**************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.927363IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-18363IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-11525IPR002100Transcription factor, MADS-box
CDDcd002662.80E-29588No hitNo description
SuperFamilySSF554555.62E-24599IPR002100Transcription factor, MADS-box
PfamPF003192.1E-171353IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-112540IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-114061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MIRSKRKVKL SLIEDETTRR TTFKKRQKGL LKKVYELSTL CDVQTCAIIY SPYDVVDPEM  60
YPSKDGVNDI VSMFKRLSET DQNKRKMNLV DFVWQRFKKG EERMKKLVEE NRELVMREFM  120
FDCMKGNMFK YRYGLKDLLS LGSYIDKVIE DCTRMMNNNG GSSSNSSSSS SVLSGFHDQI  180
GSNLTEQIQY PATESTPLGF YDQFQVQNMN LAPMAATNVE FPAQGRFFHE DGIDNLRADT  240
ISALGFHDRF QYRNMNLAPN LPPMAASNGE FSSVRFQNQN LVIGGGTTSS FAPMAATNAE  300
FSVLGFDNEF NQNQNGYVGY PMNQYKNQQE NVQYPVNLNS YDNVNFGNND MNLGQVYDEN  360
QQQWLSEFME EPTQIDNGGE MLGFHFMDNN YF
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA40G00158
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.12e-34AGAMOUS-like 36