PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family M-type_MADS
Protein Properties Length: 249aa    MW: 27099.4 Da    PI: 8.1934
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00157genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.62.1e-20343242
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                +i+n+++r++tf kR++g+lKKA+EL +LCd++ +v+++s+
  AA40G00157  3 FIQNDTQRKTTFKKRKKGLLKKAQELATLCDVKTCVVVYSP 43
                89**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-17153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.708142IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-21287IPR002100Transcription factor, MADS-box
PfamPF003194.0E-19344IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-51631IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-53152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MNFIQNDTQR KTTFKKRKKG LLKKAQELAT LCDVKTCVVV YSPYESTPDV WPSSDAAREV  60
VTDWLAFPGT ERTKKMANQE SFTRHRLSKA NDSFKKLQKE NKEMEMKNII FKSFEGGSPQ  120
ISHLGFDGLQ DLGNVLDQYL KDINRRLEVL SGDSNDPSAS ASASVSASAS ASASASAAAS  180
ALVSASVSAS ASASVSASVD LENTTTTSGV ITVAEMNSTS VEFYGKIRSQ IQNKLNMNRM  240
NDIDLDLNM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1817QRKTTFKKRK
21418KKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA40G00157
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.14e-50M-type_MADS family protein