PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family M-type_MADS
Protein Properties Length: 156aa    MW: 18683.8 Da    PI: 10.1937
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00447genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.84.3e-161150342
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                i+++s r +tf kR++g+lKK +EL +LCd +++ ii+s 
  AA39G00447 11 IQDQSVRRTTFKKRKEGLLKKLNELTILCDLRACAIIYSD 50
                899***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.5E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.998150IPR002100Transcription factor, MADS-box
CDDcd001202.38E-18259No hitNo description
SuperFamilySSF554553.53E-21294IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-9323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-151150IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MGRRKITHQL IQDQSVRRTT FKKRKEGLLK KLNELTILCD LRACAIIYSD YKDEPELWPN  60
RSQVRLLLNQ LRQLPVEKRT KYMLDQKDFM RKMIQNAEKK LEKEKMNTRV MEIGLMASEN  120
EMTAADYSEE LNKAADVLRK RIKVVNERID ELEKRE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKITHQLIQDQSVRRTTFKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA39G00447
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416183.17e-75agamous-like MADS-box protein AGL80
TrEMBLA0A087HQF02e-74A0A087HQF0_ARAAL; Uncharacterized protein
STRINGA0A087HQF03e-75(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22590.24e-66AGAMOUS-like 87