PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 193aa    MW: 21969.6 Da    PI: 5.8812
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00305genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.28.1e-2080140257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t++ql++Le+ + + + +p++++++e++++l     +te++V++WFqNrRa+ k+
  AA39G00305  80 RHRWTPTTTQLQILESIYSEgSGTPNRRRIREITSELsehgTITETNVYNWFQNRRARSKR 140
                 89*****************99**************************************97 PP

2Wus_type_Homeobox101.56.1e-3379142265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPt++Q++iLe++y++G  tPn+++i++it+eL+e+G i+++NV++WFQNr+aR+++kq
         AA39G00305  79 TRHRWTPTTTQLQILESIYSEGSGTPNRRRIREITSELSEHGTITETNVYNWFQNRRARSKRKQ 142
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.46E-1775142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-1575144IPR009057Homeodomain-like
PROSITE profilePS5007114.10776141IPR001356Homeobox domain
SMARTSM003892.9E-1278145IPR001356Homeobox domain
CDDcd000869.85E-1380142No hitNo description
PfamPF000462.4E-1780140IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEMNRESQNA AFHDGRVMTE EQMEILRKQI AVYAVICDQL VVLHNSLSSL HPLSSELRLS  60
NGGYLDPILG SSSVHRISTR HRWTPTTTQL QILESIYSEG SGTPNRRRIR EITSELSEHG  120
TITETNVYNW FQNRRARSKR KQTSVVTDQI DAAATANMEE EMRSCGDSGG LEDYEHILFP  180
PPDLGILFYL FNI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA39G00305
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173493.21e-98WUSCHEL related homeobox 14
SwissprotQ9LM841e-99WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLA0A178W4J52e-97A0A178W4J5_ARATH; WOX14
STRINGAT1G20700.16e-98(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-87WUSCHEL related homeobox 14
Publications ? help Back to Top
  1. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]