PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 494aa    MW: 56345.4 Da    PI: 5.8706
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00240genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.6e-103443811954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  AA39G00240 344 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 381
                 665559******************************88 PP

2BELL1184.4e-38207278172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erq+lq+kk+kLl++++eVdkrY+qy++q+++++ssFe++ag g+akpYts+Al++iSrhFr+L+dai++q+
  AA39G00240 207 ERQDLQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIIAGFGAAKPYTSVALNRISRHFRSLRDAIKGQV 278
                 799******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.5E-51139276IPR006563POX domain
PfamPF075267.9E-46145274IPR006563POX domain
PROSITE profilePS5007112.357322385IPR001356Homeobox domain
SMARTSM003892.8E-10325389IPR001356Homeobox domain
CDDcd000861.66E-11325386No hitNo description
SuperFamilySSF466897.27E-18326393IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-29328391IPR009057Homeodomain-like
PfamPF059206.0E-18342381IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MQSLYQEPIY QQVSSSSTQS FSQNPRNEMV FIPPTTTDLQ NASGNVVSSN ELSFHGQGLS  60
LSLGTQIQTT PLVSVPNFHY HQYQNLSNQL GFVPNSVKET LPCEVDEAGK SKEMLLDQNQ  120
HMGYGVNIGF YNNYRYETSG FVSSVLRSRY LKPAQTLLDE VVSVRKDVNK NKGGDFNNGL  180
SLDSKESELS ANPSDSNGKS PELSSGERQD LQNKKNKLLT MVDEVDKRYN QYYHQMEALA  240
SSFEIIAGFG AAKPYTSVAL NRISRHFRSL RDAIKGQVQV IKVKLGEKES SDEQGERIPR  300
LRYLDQRLRQ QRALHQQLGM VRPAWRPQRG LPENAVSILR AWLFEHFLHP YPKESEKIML  360
AKQTGLSKNQ VANWFINARV RLWKPMIEEM YKEEFGDSES SFLSKSSQEQ NTFNNEEENN  420
NNLTTTRTTN LVFSEQKQDS SCVQDETQQE MNRSEDYDDD DGLMNYNGFG IDEYRFIGGG  480
NQQDVNNRSK GEHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16331389563Homeobox protein Meis2
3k2a_B1e-16331389563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010533491.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010533500.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010533508.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLR0GWD70.0R0GWD7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.31e-175BEL1-like homeodomain 10