PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family M-type_MADS
Protein Properties Length: 395aa    MW: 46046.2 Da    PI: 6.8464
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00166genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.81.4e-23953145
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                kr e++snrqvt+skRr gilKKA+ELS+LCd+++ +++fs+tg+
  AA39G00166  9 KRLESTSNRQVTYSKRRSGILKKAKELSILCDIDIVLLMFSPTGR 53
                689****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.455161IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-27295IPR002100Transcription factor, MADS-box
CDDcd002663.67E-28282No hitNo description
PRINTSPR004042.4E-19323IPR002100Transcription factor, MADS-box
PfamPF003199.6E-211157IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGRVKLKIKR LESTSNRQVT YSKRRSGILK KAKELSILCD IDIVLLMFSP TGRPTVFHGE  60
HSCIEDVIAK FSQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHEFLGAR NQTIEGLSSQ  120
VAVFQSQIME CHRRLSCWTN IERIDNTEHL NILEETLRKS IERIQVHKVC LIFSLIKTGK  180
ILEIDVYMRY EKTIFAFLQE HFRKNQLMPL ECTTQFHSGI SLPLAMGGLQ EAHSMSWFPE  240
NDNQQTILPG DNSSFLHHRD IEGSIPVYSN CFFESMKQED QICNTGQQPH QQQLEQQIEQ  300
EGNRCLNIQQ LGEAYSFQTP FGATLLMEEE KKIESEMEFN LQHQQQHQDP AIMFHHQTVN  360
NGFHDQSMFA THHHHHQNWV QDSMFGQTSY NQQPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-13192190MEF2C
5f28_B2e-13192190MEF2C
5f28_C2e-13192190MEF2C
5f28_D2e-13192190MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA39G00166
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431721e-157AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660239.10.0agamous-like MADS-box protein AGL65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A3P5YL320.0A0A3P5YL32_BRACM; Uncharacterized protein
STRINGBostr.7128s0485.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-176AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]