PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA38G00045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 326aa    MW: 36866.4 Da    PI: 4.8763
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA38G00045genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.61e-082693032155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yp++ ++  LA+ +gL+++q+ +WF N+R ++
  AA38G00045 269 KWPYPTEGDKIALADATGLDQKQINNWFINQRKRH 303
                 569*****************************885 PP

2ELK31.73.4e-11223244122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 +LK++LlrK++++++sLk EFs
  AA38G00045 223 DLKDRLLRKFGSHISSLKLEFS 244
                 69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-2283127IPR005540KNOX1
PfamPF037901.8E-2185126IPR005540KNOX1
SMARTSM012566.5E-25134185IPR005541KNOX2
PfamPF037917.1E-24138184IPR005541KNOX2
SMARTSM011881.6E-5223244IPR005539ELK domain
PROSITE profilePS512139.847223243IPR005539ELK domain
PfamPF037895.5E-8223244IPR005539ELK domain
PROSITE profilePS5007112.341243306IPR001356Homeobox domain
SuperFamilySSF466894.71E-19244316IPR009057Homeodomain-like
SMARTSM003891.5E-12245310IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-27248307IPR009057Homeodomain-like
CDDcd000861.16E-11252307No hitNo description
PfamPF059202.9E-17263302IPR008422Homeobox KN domain
PROSITE patternPS000270281304IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDGMCGYHST GDYSEKAAMM VSSENLMMPS HYQTMLYSSA EDNRVSDVYG SNELLSAAAS  60
ALSSEAVSIA THIRRAEDNV TLGVIKAKIA CHPFYPRLLQ AYIDCQKVGA PVEIACLLEE  120
IQRESDVYKR DVAPLSCLGA DPELDDFMET YCEILIKYKS DLARPFDEAT TFLNKIEVQL  180
QNLCTGPAST RGVSDDGTIS SDEELRGGDD IVQDSQQRSN DRDLKDRLLR KFGSHISSLK  240
LEFSKKKKKG KLPREARQAL LDWWNVHYKW PYPTEGDKIA LADATGLDQK QINNWFINQR  300
KRHWKPSENM PFSMVDDSSE TFYTEE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850951.20.0homeobox protein knotted-1-like 6
SwissprotQ84JS60.0KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7KNF21e-177D7KNF2_ARALL; Putative uncharacterized protein
STRINGAT1G23380.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-174KNOTTED1-like homeobox gene 6