PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA37G00096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 166aa    MW: 18366.1 Da    PI: 8.584
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA37G00096genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.6e-44141131100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv k+l++l+e++r+da++s+vyeA ar++dP+yG+vg+i++lq+qle+l+++la +++
  AA37G00096  14 PCAACKLLRRKCVRDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQELSESHRSDAVNSMVYEATARVQDPIYGCVGTISSLQRQLETLQTQLAFAQA 112
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  AA37G00096 113 E 113
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3713114IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4214111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MREKGEKHGG AGSPCAACKL LRRKCVRDCV FAPYFPAKEP YKFAIVHKIF GASNVNKMLQ  60
ELSESHRSDA VNSMVYEATA RVQDPIYGCV GTISSLQRQL ETLQTQLAFA QAELVNVKMM  120
FRRIDNTKPP PYTAIPATLP ANNKPFSGVD VAFVYEDATG DSLWSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-46101157112LOB family transfactor Ramosa2.1
5ly0_B1e-46101157112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA37G00096
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738422e-83AB473842.1 Arabidopsis thaliana ASL9 mRNA for ASYMMETRIC LEAVES2-like 9 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020869105.18e-93LOB domain-containing protein 3
RefseqXP_020869106.18e-93LOB domain-containing protein 3
RefseqXP_020869107.18e-93LOB domain-containing protein 3
RefseqXP_020869108.18e-93LOB domain-containing protein 3
RefseqXP_020869109.18e-93LOB domain-containing protein 3
RefseqXP_020869110.18e-93LOB domain-containing protein 3
RefseqXP_020869111.18e-93LOB domain-containing protein 3
RefseqXP_020869112.18e-93LOB domain-containing protein 3
RefseqXP_020869113.18e-93LOB domain-containing protein 3
RefseqXP_020869114.18e-93LOB domain-containing protein 3
SwissprotQ9SA511e-89LBD3_ARATH; LOB domain-containing protein 3
TrEMBLD7KEG52e-91D7KEG5_ARALL; Predicted protein
STRINGAl_scaffold_0001_17113e-92(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.18e-82ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]