PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA33G00283
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 522aa    MW: 57075.3 Da    PI: 8.0739
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA33G00283genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.1e-14113153142
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  AA33G00283 113 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVEN 153
                 589**************************.********9875 PP

2TCR50.93.1e-16192231140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  AA33G00283 192 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 231
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.5E-16113153IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.598114232IPR005172CRC domain
PfamPF036386.4E-11115150IPR005172CRC domain
SMARTSM011141.5E-19192233IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12195230IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MVEEGENGEF PPKKEVTEES DIPIKKSARQ LDFSGGLGVE HSSQSSKTTV SVHSPTTTTI  60
PRPNVMGIGQ IRSTMTVVTS QTQGLHVPLK IPKAESPKSR ARPAVESRDG TPQKKKQCNC  120
KHSRCLKLYC ECFASGTYCD GCNCVNCFNN VENEPARREA VEATLDRNPN AFRPKIASSP  180
HGARDNKEEI AKHNKGCHCK KSGCLKKYCE CFQANILCSE NCKCLDCKNF EGSDERQALF  240
HGEHSQNLAY LQHNTNAAIT GAVGSSGFAP SPAPKRKKTQ EIFFTQATKD SSKQFQQVTS  300
PTPVSTAGGN SPLVSSSKPA YSSLLADIVH LQDVKALCSV LVTVSDERSK IPLPDQSNKR  360
LEDQTETSLA SSTQDQGEIK AANGPLSPAT LALMCDEKDT MFMVADSPTT TSQLPNGQDQ  420
VYAEQERVIL TKFRDCLSRI ISYGELKESN CSLSRMELDS PVHTSVKIEP REPREQQGPV  480
VNGVSRTITT PTKQQTSQLI TRTIPQNTSQ IHLHKPPALP EK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-3311524111132Protein lin-54 homolog
5fd3_B2e-3311524111132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA33G00283
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010526465.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLA0A1J3DZA10.0A0A1J3DZA1_NOCCA; Protein tesmin/TSO1-like CXC 6
STRINGBostr.7903s0158.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein