PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00863
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 232aa    MW: 25366.7 Da    PI: 4.6241
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00863genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.3e-43491481100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++ 
  AA32G00863  49 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKAQV 147
                 7**********************************************************************************************9986 PP

      DUF260 100 e 100
                 e
  AA32G00863 148 E 148
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.28548149IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4249146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MLKMEINGVA TPNASTAVTA VTDSVTPVSS PSPTSSPPQA QQPPVVLSPC AACKILRRRC  60
AEKCVLAPYF PPTDPAKFTI AHRVFGASNI IKFLQELPES QRTDAVNSMV YEAGARMRDP  120
VYGCAGAIYH LQRQVSELQA QLAKAQVELV NVQLQRSNLL ELIYKLDQPI NIISGQEQVV  180
VGQHNNMSLE SSFESGDDFI SSPEEESNEL GFLEDNVFNN NSSMSLWGPL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-41441516113LOB family transfactor Ramosa2.1
5ly0_B4e-41441516113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA32G00863
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892992e-40AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180417.21e-115LOB domain-containing protein 11
SwissprotQ9SK081e-116LBD11_ARATH; LOB domain-containing protein 11
TrEMBLR0FXT91e-112R0FXT9_9BRAS; Uncharacterized protein
STRINGAT2G28500.11e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-108LOB domain-containing protein 11