PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Dof
Protein Properties Length: 344aa    MW: 37475.9 Da    PI: 9.7514
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00832genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.12e-3893151361
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 e alkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk 
  AA32G00832  93 EGALKCPRCDSSNTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKG 151
                 5679****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3378147IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3295150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.75896150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVFSSFSSFL DPPINWPQSS SNPNNHPHHL QLQESGNLVN GNQVISHQFP PNPNPTHHHA  60
SDHLDTSAAN NDPARLNGSA AERARLAKNS QTEGALKCPR CDSSNTKFCY FNNYNLTQPR  120
HFCKACRRYW TRGGALRNVP VGGGCRRNKK GKNGNSKSST SSSNNNKQSS SMVNNNNTQN  180
PTNTNNTFQQ LTQFPFLPTL QNLTQLGGIG LNLAAINGNN GNNTSSSSLL NDLPFFHVGN  240
GPNTSGMINN NEHNIMTSLG STNHFTLFDR ATGLYGFQNE SNQINAPRVV VAPVKMEEAN  300
MGNNANRPVS GSTSPVNQSN YWTGLGFPGS SSNDNHNHHH NNLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA32G00832
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850126.11e-137Dof-type zinc finger DNA-binding family protein
SwissprotQ9ZV331e-138DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A178VZ401e-136A0A178VZ40_ARATH; Uncharacterized protein
STRINGAT2G28810.11e-136(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.14e-79Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]