PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00667
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 263aa    MW: 28546.2 Da    PI: 8.4842
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00667genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.65e-39551541100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdPvyG++g i++l++++++l+++l+++++
  AA32G00667  55 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPVYGCMGAISALHHHINSLQSQLSAVRT 153
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  AA32G00667 154 E 154
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.06754155IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-4055152IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSREREEFGE YYEIVKKIKK DQSFETTPDH VVMGIKRHVA APPLPLGTTL NTVTPCAACK  60
LLRRRCAEEC PFSPYFSPHE PHKFAAVHKV FGASNVSKML LEVGESQRGD AANSLVYEAN  120
LRLRDPVYGC MGAISALHHH INSLQSQLSA VRTEILRHKY RQANNNNNNF IITSSTSVSD  180
AQAALALLLP SGLASPPPPL RSQMNSAPPP LTPPPSLPSP SIVVSSSSTS SNSSATNSMY  240
NPPSSAAGFN NSMSSDNNLH FFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-40481584114LOB family transfactor Ramosa2.1
5ly0_B1e-40481584114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA32G00667
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018433132.11e-113PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 13
SwissprotQ9AT611e-111LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A087G3R61e-111A0A087G3R6_ARAAL; Uncharacterized protein
STRINGA0A087G3R61e-112(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-106LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]