PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 317aa    MW: 34016.8 Da    PI: 7.7883
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00737genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822217.43.2e-6721431149
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++p+ ++++ag sa+asp+ss+q    
  AA31G00737   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCRPE-RMDIAGGSATASPCSSYQ---- 95 
                 5899***********************************************************************9.******************.... PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                     +sp++sy++sp+ss+f+sp+s+++++l+s   +sl+p+l++ls++sss
  AA31G00737  96 ----PSPCASYNPSPASSNFMSPASSSFMNLTSGdgQSLIPWLKHLSTTSSS 143
                 ....*************************9998888**********997776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-643138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCRPERMD IAGGSATASP CSSYQPSPCA SYNPSPASSN FMSPASSSFM  120
NLTSGDGQSL IPWLKHLSTT SSSSASSSSR LPYLYIPGGS ISAPVTPPLS SPTARTPRMN  180
PDWQQNNSFF VSSTPPSPTR QIIPDSEWFS GIQLPQSVPA SPTFSLVSPN TFGFKEEASA  240
NGAGSRMWTP GQSGTCSPAI PSGDVPMSEA MAVAAAAPEF AFGSNANGLV KAWEGERIHE  300
ESGSDDLELT LGNSSTR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006389963.11e-177hypothetical protein EUTSA_v10018888mg
SwissprotQ9ZV881e-177BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLV4K8A21e-177V4K8A2_EUTSA; Uncharacterized protein
STRINGAT1G78700.11e-174(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-141BES1/BZR1 homolog 4