PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 271aa    MW: 31317.5 Da    PI: 5.4228
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00412genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.8e-102012381954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 F+   ++yp+ +e+  LA+++gL+++qV++WF N R +
  AA31G00412 201 FHHflHPYPNDAEKLMLASQTGLSKNQVSNWFINARVR 238
                 554459******************************98 PP

2BELL98.26.5e-3274145172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e +e+q++++kLl+ll++V++r++ y++ql++vissFe+++g gs+k+Yt lAl+a+ rhF +L+dai++qi
  AA31G00412  74 ETHEIQIRISKLLDLLQQVEERFESYYNQLEQVISSFEEIVGEGSSKVYTGLALQAMIRHFCSLQDAIISQI 145
                 679********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-149143IPR006563POX domain
PfamPF075263.2E-2917141IPR006563POX domain
SMARTSM003896.4E-10182246IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-27187248IPR009057Homeodomain-like
CDDcd000864.36E-11188243No hitNo description
SuperFamilySSF466895.99E-18188250IPR009057Homeodomain-like
PfamPF059201.7E-17199238IPR008422Homeobox KN domain
PROSITE profilePS5007111.758201242IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEEDRVRNSK CSSSFLDSRY LKAIRYLLEE VIDIGGKEVE LCNDLLVQQT RTGFNLASEI  60
KTEFFASGLM SLPETHEIQI RISKLLDLLQ QVEERFESYY NQLEQVISSF EEIVGEGSSK  120
VYTGLALQAM IRHFCSLQDA IISQISSLRR RFSQDVPYRQ FSTTVSSLQR LGLVQGPQKH  180
AWKPIRGLPE TSVAILRAWL FHHFLHPYPN DAEKLMLASQ TGLSKNQVSN WFINARVRLW  240
KPMIEEMYRE EFGDSSDESL QREGNGEHFD D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-17188249566Homeobox protein Meis2
3k2a_B5e-17188249566Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390303.11e-145hypothetical protein EUTSA_v10018958mg
SwissprotQ1PFD11e-145BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLV4K9881e-145V4K988_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0002_22471e-143(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97362734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-146BEL1-like homeodomain 11