PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00067
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Whirly
Protein Properties Length: 305aa    MW: 33499.6 Da    PI: 9.8261
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00067genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly174.52.3e-54881982112
      Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
                 v+k+kaal+v++v+p+f +++sg l+++r+G+l+l++++a++erkydWekkq+falsatev++l++++s +s+effhdp++k+sn+G+vrk+l+++P+ 
  AA31G00067  88 VFKGKAALSVEPVLPSFIKIESGDLRIERRGSLMLTFMPAVGERKYDWEKKQRFALSATEVGSLISMGSSDSSEFFHDPSMKSSNAGQVRKSLSIKPHG 186
                 9************************************************************************************************** PP

      Whirly 101 dGsGlfvnlsvt 112
                 dGsG+f++ls  
  AA31G00067 187 DGSGYFISLSKA 198
                 *********965 PP

2Whirly22.42.1e-07237264110137
      Whirly 110 svtnslvkgnesfsvPvskaefavlrsl 137
                  v+ns++k+ e+f+vPv+ aefav++++
  AA31G00067 237 GVNNSILKTTERFVVPVTTAEFAVMKTA 264
                 489***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.3E-5374198IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.04E-4579197IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.9E-4888198IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.103.0E-14235283IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544475.96E-15237304IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MLKQARTLLS RNLCNQSNSV FEGKVRASTL RGFASWADSS TNGGGFSGKG KVYFQLNVCF  60
VCSGNCCLNF DFKDAGKPSG RVFAPYAVFK GKAALSVEPV LPSFIKIESG DLRIERRGSL  120
MLTFMPAVGE RKYDWEKKQR FALSATEVGS LISMGSSDSS EFFHDPSMKS SNAGQVRKSL  180
SIKPHGDGSG YFISLSKASI KLIKVVLCKD VKATPVFSWI LIFESCTTTY FLLSIAGVNN  240
SILKTTERFV VPVTTAEFAV MKTACSFALP HIMGWDRLTT GQVGTSTQRY TSKLDPQQLE  300
LEWDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A2e-97732792167Single-stranded DNA-binding protein WHY2, mit
4kop_B2e-97732792167Single-stranded DNA-binding protein WHY2, mit
4kop_C2e-97732792167Single-stranded DNA-binding protein WHY2, mit
4kop_D2e-97732792167Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010415836.11e-121PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial-like
SwissprotQ8VYF71e-121WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLR0GIE31e-121R0GIE3_9BRAS; Uncharacterized protein
STRINGAT1G71260.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM123582731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-114WHIRLY 2