PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00195
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family TALE
Protein Properties Length: 542aa    MW: 60317.8 Da    PI: 7.1793
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00195genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093473841954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  AA30G00195 347 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 384
                 554458******************************88 PP

2BELL123.58.7e-40205276172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +r e+q++k+kLl +leeVd+rY++y+eq+qtv++sF++v+g+g+a pYtslA+ka+SrhFrcLkdaia q+
  AA30G00195 205 DRIEHQRRKVKLLAMLEEVDRRYNHYCEQMQTVVNSFDMVMGHGAALPYTSLAQKAMSRHFRCLKDAIAAQL 276
                 589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-64137274IPR006563POX domain
PfamPF075267.0E-48142273IPR006563POX domain
PROSITE profilePS5007112.552325388IPR001356Homeobox domain
CDDcd000863.82E-11328389No hitNo description
SMARTSM003892.7E-9328392IPR001356Homeobox domain
SuperFamilySSF466894.18E-17330396IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28331394IPR009057Homeodomain-like
PfamPF059202.5E-18345384IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MSQQIFTFSN EFNHQMDNNH SITGDEIPVY QNAGMLSEMF NHIPVNNLTD STLHMLLPNH  60
HQALSLSLSS TLEAAAASKS EDFRSFYSSS SNQNRSISQD FSYFNTHYHQ FNQFKTQLFR  120
SSPAAGAVAV AASASSSSSF NILRTSRYAI AAQELLEEFC SVGRGQFKKN NKLISGGGGG  180
VSGGGGGGGA VKDDNNSFDS LSASDRIEHQ RRKVKLLAML EEVDRRYNHY CEQMQTVVNS  240
FDMVMGHGAA LPYTSLAQKA MSRHFRCLKD AIAAQLKLSC ERLGDKNAEG NSSSRLTKGE  300
TPRLRLLEQS LRQQRAFHSM GMMEQEAWRP QRGLPERSVN LLRAWLFEHF LHPYPSDADK  360
HLLARQTGLS RNQVSNWFIN ARVRLWKPMV EEMYQQESNE IENQENEKNQ ENEEEEINKK  420
DKSSKSNNNE NNFTIARTTS QTPIQSLNAN ANANAGVLGP HRLRSNNVYE NDPSSLLLSP  480
STSTAAFSVV ATCQQSIGGD DDVIRFGTNQ TGDVSLTLGL RHAGNVSHKE SSSFCVRDFG  540
GF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-17334391158Homeobox protein Meis1
4xrs_B8e-17334391158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411954.10.0hypothetical protein EUTSA_v10024509mg
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A078BY390.0A0A078BY39_BRANA; BnaC01g02010D protein
STRINGfgenesh1_pm.C_scaffold_70003080.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-160BEL1-like homeodomain 2