PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 265aa    MW: 29828.2 Da    PI: 6.4226
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00079genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.8e-2197157257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t+ ql++Le+ F + + +ps++++++++++l    +++e++V++WFqNrRa+ k+
  AA30G00079  97 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITSELsqhgQISETNVYNWFQNRRARSKR 157
                 89*****************99**************************************97 PP

2Wus_type_Homeobox103.51.4e-3396159265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
         AA30G00079  96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITSELSQHGQISETNVYNWFQNRRARSKRKQ 159
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-1892160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-1792160IPR009057Homeodomain-like
PROSITE profilePS5007114.73893158IPR001356Homeobox domain
SMARTSM003894.1E-1495162IPR001356Homeobox domain
PfamPF000467.3E-1997157IPR001356Homeobox domain
CDDcd000862.51E-1397159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MMEWDNQQQT NNTHHTSNFN RIDVNGGSNG PGMYVKVMTD EQLETLRKQI AIYATICERL  60
VEMHKTLTAQ QDLAGGRLGG LYADPMMSSV GHKMTARQRW TPTPVQLQIL ERIFDQGTGT  120
PSKQKIKDIT SELSQHGQIS ETNVYNWFQN RRARSKRKQQ GCGSSNNNGE SEVETEVESL  180
NEKRTRPETL LNNNGGNNNV MGKTTTTTTT PRPEDLCFQS PEMSSELHLL GVLANPRDEH  240
LVGKMGLPES YNLYDHHVED YGMSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150158RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA30G00079
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867068.11e-146WUSCHEL-related homeobox 13
SwissprotO817881e-142WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLD7MCZ41e-145D7MCZ4_ARALL; Homeobox-leucine zipper protein
STRINGBostr.7867s1413.1.p1e-146(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-138WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]