PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA29G00228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 207aa    MW: 22614.6 Da    PI: 8.5893
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA29G00228genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.4e-42201191100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael ++++
  AA29G00228  20 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQVQALQAELTAVRS 118
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  AA29G00228 119 E 119
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.94519120IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4220117IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MAGFRRPMLG PPGTLNTITP CAACKLLRRR CAQECPFSPY FSPHEPHKFA SVHKVFGASN  60
VSKMLMEVPE SQRADAANSL VYEANVRLRD PVYGCMGAIS TLQQQVQALQ AELTAVRSEI  120
LKYKQREAVA ANTLINIPSN SHQISSFLSS GAVSVITPQP QTPSTPPQPP VTHQHPPPPS  180
SSSCVYSQQT SRGLQYSDIE SENNSYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-45121393124LOB family transfactor Ramosa2.1
5ly0_B6e-45121393124LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA29G00228
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141907.11e-105PREDICTED: LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T55e-97LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A087H4761e-112A0A087H476_ARAAL; Uncharacterized protein
STRINGA0A087H4761e-113(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-85LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]