PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family WOX
Protein Properties Length: 340aa    MW: 39299.5 Da    PI: 6.7956
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00472genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54e-2271130357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t++ql++Le+l+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  AA26G00472  71 SRWNPTPDQLRVLEDLYRQgTRTPSAEQIQQITSQLkrygKIEGKNVFYWFQNHKARERQ 130
                 7*****************99**************************************97 PP

2Wus_type_Homeobox117.55.9e-3870132365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+Ptp+Q+++Le+ly++G+rtP++e+iq+it++L++yGkie+kNVfyWFQN+kaRerqk+
         AA26G00472  70 SSRWNPTPDQLRVLEDLYRQGTRTPSAEQIQQITSQLKRYGKIEGKNVFYWFQNHKARERQKR 132
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.6E-568135IPR001356Homeobox domain
SuperFamilySSF466891.31E-1270136IPR009057Homeodomain-like
PfamPF000467.9E-2071130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-971130IPR009057Homeodomain-like
CDDcd000862.49E-672132No hitNo description
PROSITE profilePS5007111.2476131IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MWMMGYNEGA QDSLSTNRKL RPLIPRLSSA ANTTSDHRFN IVATMAVDQN KRELMMMNSE  60
IQNHPPLVVS SRWNPTPDQL RVLEDLYRQG TRTPSAEQIQ QITSQLKRYG KIEGKNVFYW  120
FQNHKARERQ KRRRQMETEQ QQQQYNQEES VITTTNHGFD KKDSPDYKVE QTKNWICSVG  180
CDTQPEKVHD DEESISITMV AAAANKWAEI NGAHRQRGNT NATWHHMMHL PPGLYPSPHH  240
HLILNSSTVS SNISTTNVSS AKDTATDDLQ SLVTNREIGQ RHGQRQNDHQ ESDEDCSKNQ  300
DQTLELFPLR KEGFCNNGGD YEKEKESEIH CFYEFLPLKN
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA26G00472
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015601.11e-145WUSCHEL-related homeobox 1
SwissprotQ6X7K01e-130WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A078JGB91e-143A0A078JGB9_BRANA; BnaCnng51820D protein
STRINGBo5g121370.11e-143(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-112WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]