PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00319
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family CPP
Protein Properties Length: 337aa    MW: 37255.5 Da    PI: 8.1157
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00319genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.39.9e-1662100241
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 ++kgC+C++skClk+YCeCfa+g++Cs+ C C +C+N+ e
  AA26G00319  62 KHKGCHCRHSKCLKLYCECFASGVFCSD-CDCVNCHNNIE 100
                 789*************************.********976 PP

2TCR48.41.8e-15145183341
         TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                 ++gC+Ck++kClkkYCeCf+a++ Cs +CkC +C+N++e
  AA26G00319 145 SRGCKCKRTKCLKKYCECFQANTVCSVNCKCINCENNNE 183
                 589*********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-1861101IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.29462183IPR005172CRC domain
PfamPF036381.1E-126498IPR005172CRC domain
SMARTSM011148.5E-14143184IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.7E-12146181IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDSRTIATAK NPRELVFTKL ELSPVVLVSP AVELPLFPPL SRESSKTPEK DKANQEGITW  60
RKHKGCHCRH SKCLKLYCEC FASGVFCSDC DCVNCHNNIE NHDAREAAVI SVIDRKPNAF  120
KGKPSISAID YQSEVKPDTK LGIGSRGCKC KRTKCLKKYC ECFQANTVCS VNCKCINCEN  180
NNEEFKSRPA LNVIPEVSIQ NSLDSPTSSS PKLPFRKKRP QLRNTTLLHD SRDLCSLLLA  240
ASQSATASSG NTPVFEVPSG IEDESKNIVL GGHNNVSSGG LIKLIDAQCN GDASQVITKI  300
SNQETDLYME QERAVLETFR DSLNKLIEFG FIKVWHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-20611839123Protein lin-54 homolog
5fd3_B6e-20611839123Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA26G00319
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188237.21e-119Tesmin/TSO1-like CXC domain-containing protein
SwissprotQ700D01e-120TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLV4M7I21e-130V4M7I2_EUTSA; Uncharacterized protein (Fragment)
STRINGXP_006406870.11e-130(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.11e-103Tesmin/TSO1-like CXC domain-containing protein