PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00234
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family SBP
Protein Properties Length: 183aa    MW: 20869.4 Da    PI: 10.3118
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00234genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.3e-4265140277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv++C++dl+eak+yhrrhkvCevh+k +++ v+g++qrfCqqCsrfhel efD++krsCrrrLa+hnerrrk++
  AA26G00234  65 CQVDRCTTDLTEAKQYHRRHKVCEVHAKVSAASVAGVRQRFCQQCSRFHELPEFDDAKRSCRRRLAGHNERRRKSS 140
                 **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375754.2E-551151IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.107.8E-3261126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.81262139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3864143IPR004333Transcription factor, SBP-box
PfamPF031104.8E-3165138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEGKTTQGRG YLKEKAAVSS LVGEEMENDM NGEDEIGGEE DKRNRTVERV RGRSSGSDRV  60
PSRLCQVDRC TTDLTEAKQY HRRHKVCEVH AKVSAASVAG VRQRFCQQCS RFHELPEFDD  120
AKRSCRRRLA GHNERRRKSS GDSLGEGSGR RSFNGQLIQT QERPRIEMKM PMPSSSFKRP  180
QIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-4054138284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298553.18e-99hypothetical protein CARUB_v10014636mg, partial
SwissprotQ9S7583e-95SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLR0G7J69e-99R0G7J6_9BRAS; Uncharacterized protein (Fragment)
STRINGAT3G15270.17e-93(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.14e-80squamosa promoter binding protein-like 5