PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 274aa    MW: 31325 Da    PI: 6.6371
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00101genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601278.6e-40381371100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l+++e+++am++++++++ara+dPv G++++i++lq q+e +++el+ + +
  AA26G00101  38 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKSLNPSEKDAAMHTIMFQSDARAKDPVGGCYRIIRELQYQIEYSRNELEIVLQ 136
                 7*********************************************************************************************99877 PP

      DUF260 100 e 100
                 +
  AA26G00101 137 Q 137
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.21837138IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3638134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MPSGKASVFP LHPKPSPPPL KPSSNIPRTG NSTSTNQACA ACKYQRRKCA PDCLLAPYFP  60
HDRHRQFLNA HKLFGVSNIT KIIKSLNPSE KDAAMHTIMF QSDARAKDPV GGCYRIIREL  120
QYQIEYSRNE LEIVLQQLAV FRDRAHHQEQ QQQQPHIQIQ EPEDISSFSS SCDPNNNSLP  180
FNYPLHLQEQ QHQQQQQQQY CSSGNFNGLQ EDMWCLQLQD SSTTVNMKGG FIDECEDVKP  240
VEEVSSERHD QFEHEGFVDQ RKLNMPSAQF IISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-26311384111LOB family transfactor Ramosa2.1
5ly0_B5e-26311384111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA26G00101
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298101.11e-145LOB domain-containing protein 22
RefseqXP_023642605.11e-145LOB domain-containing protein 22
SwissprotQ9LRW11e-145LBD22_ARATH; LOB domain-containing protein 22
TrEMBLR0HMS11e-144R0HMS1_9BRAS; Uncharacterized protein
TrEMBLR0I3Y51e-144R0I3Y5_9BRAS; Uncharacterized protein
STRINGXP_006298101.11e-145(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-126LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]