PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA23G00026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family LBD
Protein Properties Length: 180aa    MW: 20867.3 Da    PI: 9.6239
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA23G00026genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260105.73.9e-3327118192
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                 aCa+Ck++r+kC+kdC+l+ yfp +++k+f++vhk+FG+sn++k++++++ee+r+++ +sl++eA +r++dP+ G++g ++++ ++l+  k+
  AA23G00026  27 ACASCKHQRKKCNKDCILSLYFPVRKTKEFQAVHKVFGVSNIQKMVRSVREEDRTKLSDSLTWEALWRQKDPILGSYGEYRRICEELKLYKS 118
                 7************************************************************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.20626126IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3027118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MQRNPNNNNN NNNNNNNISS NSSSHQACAS CKHQRKKCNK DCILSLYFPV RKTKEFQAVH  60
KVFGVSNIQK MVRSVREEDR TKLSDSLTWE ALWRQKDPIL GSYGEYRRIC EELKLYKSLV  120
HHQPRVIGWE NHHQQSCGLG GFSVNNDGEI NGGYTSRNIQ DQRQQCYAVI NGFKQHYLPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-1619104388LOB family transfactor Ramosa2.1
5ly0_B1e-1619104388LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAA23G00026
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417938.12e-89LOB domain-containing protein 2
SwissprotQ9LNB98e-88LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ14e-88V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_006417938.17e-89(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-90LOB domain-containing protein 2